Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MDIRKIKKLIDLMIESDLQAIEVKEGDQSIALTRRNPVVAAAGVALPAAPVAEAPVAKTPRGAVETSPMVGVFYAAPSPGEAPFVKVGQTVSAGETLGIIEAMKIMNPIEATQSGVIEEILVKNGEVIQFGQPLFRYRA 5KS8 Chain:D ((542-616)) ---------------------------------------------------------RPTHAGCVTTAMPGTIVD-------VKVNVGDKVSAGDAVLVIEAMKMENEIQASKSGVVVAINVKKGDSVTPDEALLEIQP

General information: TITO was launched using: RESULT: Template: 5KS8.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain D - contact count / total energy / energy per contact / energy per residue : 342 -38790 -113.42 -517.20 target 2D structure prediction score : 0.48 Monomeric hydrophicity matching model chain D : 0.69 3D Compatibility (PKB) : -113.42 2D Compatibility (Sec. Struct. Predict.) : 0.48 1D Compatibility (Hydrophobicity) : 0.69 QMean score : 0.325

(partial model without unconserved sides chains): PDB file : Tito_5KS8.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5KS8-query.scw PDB file : Tito_Scwrl_5KS8.pdb: