Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-------------------------------MKKLSIGLIIMLSLFGCTDSKAKNQEKFLTHIHNNTPEPYKECMVMYIKNHWDDVWKTYDSEKVREARGETDIVNFMIERFLPECKK------------------------------------------------------------------------------------------
5A34 Chain:B ((19-232))DLNSVLGKDYGALKDIVINANPASPPLSLLVLHRLLCEHFRVLSTVHTHSSVKSVPENLLKCFGRQ---DYQLGFTLIWKNVPKTQMK-FSIQTMCPIEGEGNIARFLFSLFGQKHNAVNATLIDSWVDIAIFQLKEGSSKEKAAVFRSMNSALGKSPWLAGNELTVADVVLWSVLQQISVTVPANVQRWMRSCENLAPFNTALKLLK


General information:
TITO was launched using:
RESULT:

Template: 5A34.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 262 -4910 -18.74 -59.15
target 2D structure prediction score : 0.33
Monomeric hydrophicity matching model chain B : 0.56

3D Compatibility (PKB) : -18.74
2D Compatibility (Sec. Struct. Predict.) : 0.33
1D Compatibility (Hydrophobicity) : 0.56
QMean score : 0.185

(partial model without unconserved sides chains):
PDB file : Tito_5A34.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-5A34-query.scw
PDB file : Tito_Scwrl_5A34.pdb: