Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WNHGNITRSKAEELLSRTGKDGSFLVRASESISRAYALCVLYRNCVYTYRILPNEDDKFTVQASEGVSMRFFTKLDQLIEFY 3IMJ Chain:B ((8-83)) WFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVK------FNSLNELVDYH

General information: TITO was launched using: RESULT: Template: 3IMJ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 277 -47430 -171.23 -624.08 target 2D structure prediction score : 0.63 Monomeric hydrophicity matching model chain B : 0.77 3D Compatibility (PKB) : -171.23 2D Compatibility (Sec. Struct. Predict.) : 0.63 1D Compatibility (Hydrophobicity) : 0.77 QMean score : 0.606

(partial model without unconserved sides chains): PDB file : Tito_3IMJ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3IMJ-query.scw PDB file : Tito_Scwrl_3IMJ.pdb: