Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence KITVCQVELWGADSTKPSDTAWVSPGGIARFTVKFGRHS----LFLYAKTSGDCTPSPVLEGPSRWGTHTIKGSLQEKQKGTVLIQEVSMKEATRGHP 1KW6 Chain:B ((231-271)) ----------------------------GRITSLLGRHTNDQTLSFYADT-----PSPMIEVEFGWGPRTVDSS------------------------

General information: TITO was launched using: RESULT: Template: 1KW6.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 96 4705 49.01 127.16 target 2D structure prediction score : 0.41 Monomeric hydrophicity matching model chain B : 0.68 3D Compatibility (PKB) : 49.01 2D Compatibility (Sec. Struct. Predict.) : 0.41 1D Compatibility (Hydrophobicity) : 0.68 QMean score : 0.214

(partial model without unconserved sides chains): PDB file : Tito_1KW6.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1KW6-query.scw PDB file : Tito_Scwrl_1KW6.pdb: