Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MPSCTKVIPALKSLAEIIIFAPSFLYHNQLYCIRQPARKLEYSLSFKVSCLFVRKINTGKRCYRNIFFFQAFDFYFFSCYR 2VIM Chain:A ((32-48)) -GPCRNIAPKVEALAKEI---------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 2VIM.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 3 -1007 -335.67 -59.24 target 2D structure prediction score : 0.59 Monomeric hydrophicity matching model chain A : 0.51 3D Compatibility (PKB) : -335.67 2D Compatibility (Sec. Struct. Predict.) : 0.59 1D Compatibility (Hydrophobicity) : 0.51 QMean score : 0.691

(partial model without unconserved sides chains): PDB file : Tito_2VIM.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2VIM-query.scw PDB file : Tito_Scwrl_2VIM.pdb: