Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence DDAHAVEDTNNNRRSCYYTIFHRAGREWRQIRQTITQITPNCVVNNIRGIPKFWVDDDCTPNYQKSEEVYIRVTAEGAKNYPEPPGFPSGCSLRGRPGSKWKSWGELTPLKQPMRRG 3LPP Chain:A ((574-622)) -------------------------ASWEQMEWSITG----MLEFSLFGIP-LVGADICGFVAETTEELCRRWMQLGAF--------------------------------------

General information: TITO was launched using: RESULT: Template: 3LPP.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 116 -7783 -67.09 -158.83 target 2D structure prediction score : 0.71 Monomeric hydrophicity matching model chain A : 0.62 3D Compatibility (PKB) : -67.09 2D Compatibility (Sec. Struct. Predict.) : 0.71 1D Compatibility (Hydrophobicity) : 0.62 QMean score : 0.214

(partial model without unconserved sides chains): PDB file : Tito_3LPP.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3LPP-query.scw PDB file : Tito_Scwrl_3LPP.pdb: