Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence GCQVELLNINQAVVGSGCVPFNYYANIYDSITRAGYTVEANINCGLKFQAGRRIPDGYSLRRAGYC 1CMC Chain:B ((64-79)) -----------------------------------------------AFTGQPLPDDADLRKE---

General information: TITO was launched using: RESULT: Template: 1CMC.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 5 244 48.80 15.25 target 2D structure prediction score : 0.94 Monomeric hydrophicity matching model chain B : 0.52 3D Compatibility (PKB) : 48.80 2D Compatibility (Sec. Struct. Predict.) : 0.94 1D Compatibility (Hydrophobicity) : 0.52 QMean score : 0.694

(partial model without unconserved sides chains): PDB file : Tito_1CMC.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1CMC-query.scw PDB file : Tito_Scwrl_1CMC.pdb: