Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence YCEYYIKTLEGWELVGWVKIGGQDELTWKGDSIGVKAEDTNCKVVLVNGQRAPVWLTAVP 4JE3 Chain:B ((421-434)) ---------------------------------------------LINIDKVPGWLAGE-

General information: TITO was launched using: RESULT: Template: 4JE3.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 9 -2425 -269.39 -173.18 target 2D structure prediction score : 0.57 Monomeric hydrophicity matching model chain B : 0.56 3D Compatibility (PKB) : -269.39 2D Compatibility (Sec. Struct. Predict.) : 0.57 1D Compatibility (Hydrophobicity) : 0.56 QMean score : 0.787

(partial model without unconserved sides chains): PDB file : Tito_4JE3.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4JE3-query.scw PDB file : Tito_Scwrl_4JE3.pdb: