Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence NCTANILNINEVVIATGCVPAGGNLIIRVGSDHSYLIRATVSCGLSLNPSQSFINGESLASGGRC 4UJ8 Chain:A ((33-82)) ---------NDVQLKVYAVDANGNIVGDITNDVTITSEATDTNGVIVNASKSTANGDTV------

General information: TITO was launched using: RESULT: Template: 4UJ8.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 95 -4947 -52.07 -98.94 target 2D structure prediction score : 0.42 Monomeric hydrophicity matching model chain A : 0.75 3D Compatibility (PKB) : -52.07 2D Compatibility (Sec. Struct. Predict.) : 0.42 1D Compatibility (Hydrophobicity) : 0.75 QMean score : 0.028

(partial model without unconserved sides chains): PDB file : Tito_4UJ8.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4UJ8-query.scw PDB file : Tito_Scwrl_4UJ8.pdb: