Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence CFHHKISRDEAQRLIIQQGLVDGVFLVRDSQSNPKTFVLSMSHGQKIKHFQIIPVEDDGEMFHTLDDGHTRFTDLIQLVEFY 2L4K Chain:A ((20-100)) -FHGRISREESQRLIGQQGLVDGLFLVRESQRNPQGFVLSLCHLQKVKHYLILPSEEEGRLYFSMDDGQTRFTDLLQLVEFH

General information: TITO was launched using: RESULT: Template: 2L4K.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 293 -20356 -69.47 -251.30 target 2D structure prediction score : 0.73 Monomeric hydrophicity matching model chain A : 0.93 3D Compatibility (PKB) : -69.47 2D Compatibility (Sec. Struct. Predict.) : 0.73 1D Compatibility (Hydrophobicity) : 0.93 QMean score : 0.385

(partial model without unconserved sides chains): PDB file : Tito_2L4K.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2L4K-query.scw PDB file : Tito_Scwrl_2L4K.pdb: