Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence YIMGFISKERERAILSTKPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIMDATNILVSPLVYLY 4Y5W Chain:A ((429-497)) -IIGFISKQYVTSLLLNEPDGTFLLRFSD-SEIGGITIAHVIRGQDGSPQIENIQPFSAKDLSIRSLGDRI--------------------

General information: TITO was launched using: RESULT: Template: 4Y5W.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 232 -28180 -121.46 -408.40 target 2D structure prediction score : 0.74 Monomeric hydrophicity matching model chain A : 0.67 3D Compatibility (PKB) : -121.46 2D Compatibility (Sec. Struct. Predict.) : 0.74 1D Compatibility (Hydrophobicity) : 0.67 QMean score : 0.717

(partial model without unconserved sides chains): PDB file : Tito_4Y5W.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4Y5W-query.scw PDB file : Tito_Scwrl_4Y5W.pdb: