Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WYSKHMTRSQAEQLLKQEGKEGGFIVRDSSKAGKYTVSVFAKSTGDPQGVIRHYVVCSTPQS--QYYLAARNCLVND 1LUK Chain:A ((8-78)) WYNKSISRDKAEKLLLDTGKEGAFMVRDSRTPGTYTVSVFTKAIISENPCIKHYHIKETNDSPKRYYVAEK------

General information: TITO was launched using: RESULT: Template: 1LUK.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 282 -12403 -43.98 -179.75 target 2D structure prediction score : 0.74 Monomeric hydrophicity matching model chain A : 0.83 3D Compatibility (PKB) : -43.98 2D Compatibility (Sec. Struct. Predict.) : 0.74 1D Compatibility (Hydrophobicity) : 0.83 QMean score : 0.673

(partial model without unconserved sides chains): PDB file : Tito_1LUK.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1LUK-query.scw PDB file : Tito_Scwrl_1LUK.pdb: