Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WFHGFITRREAERLLESKPQ-GCYLVRFSESAVTFVLTYRSRTCCRHFLLAQLRDGRHVVLGEDSAHARLQDLLLHY 5EG3 Chain:B ((9-82)) WYHASLTRAQAEHMLMRVPRDGAFLVRKRNEPNSYAISFRAEGKIKHCRVQQ--EGQTVMLG-NSEFDSLVDLISYY

General information: TITO was launched using: RESULT: Template: 5EG3.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 254 -18928 -74.52 -259.28 target 2D structure prediction score : 0.62 Monomeric hydrophicity matching model chain B : 0.79 3D Compatibility (PKB) : -74.52 2D Compatibility (Sec. Struct. Predict.) : 0.62 1D Compatibility (Hydrophobicity) : 0.79 QMean score : 0.606

(partial model without unconserved sides chains): PDB file : Tito_5EG3.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5EG3-query.scw PDB file : Tito_Scwrl_5EG3.pdb: