Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKTYHRDGKYGFSDPLTFNSVVELINHY 4L2Y Chain:B ((42-117)) WYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFSSVVELINHY

General information: TITO was launched using: RESULT: Template: 4L2Y.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 267 -26574 -99.53 -349.65 target 2D structure prediction score : 0.79 Monomeric hydrophicity matching model chain B : 0.98 3D Compatibility (PKB) : -99.53 2D Compatibility (Sec. Struct. Predict.) : 0.79 1D Compatibility (Hydrophobicity) : 0.98 QMean score : 0.890

(partial model without unconserved sides chains): PDB file : Tito_4L2Y.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4L2Y-query.scw PDB file : Tito_Scwrl_4L2Y.pdb: