Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MYQVGNFVEMKKPHACTIKSTGKKANRWEITRVGADIKIKCSNCEHVVMMGRYDFERKMNKIID 5K2M Chain:F ((9-36)) -------------------------SEIEIGEVELHQIVECPVCGAELEVVSL-----------

General information: TITO was launched using: RESULT: Template: 5K2M.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain F - contact count / total energy / energy per contact / energy per residue : 56 -12658 -226.03 -452.05 target 2D structure prediction score : 0.71 Monomeric hydrophicity matching model chain F : 0.63 3D Compatibility (PKB) : -226.03 2D Compatibility (Sec. Struct. Predict.) : 0.71 1D Compatibility (Hydrophobicity) : 0.63 QMean score : 0.635

(partial model without unconserved sides chains): PDB file : Tito_5K2M.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5K2M-query.scw PDB file : Tito_Scwrl_5K2M.pdb: