Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNTKKMSQFEIMDTEMLACVEGGGCNWGDFAKAGVGGGAVRGLQLGIKTRTWQGAATGAAGGAILGGVAYAATCWW 1B8H Chain:D ((1-11)) ---KKASLFDMFDF--------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 1B8H.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain D - contact count / total energy / energy per contact / energy per residue : 3 -452 -150.67 -41.09 target 2D structure prediction score : 0.73 Monomeric hydrophicity matching model chain D : 0.50 3D Compatibility (PKB) : -150.67 2D Compatibility (Sec. Struct. Predict.) : 0.73 1D Compatibility (Hydrophobicity) : 0.50 QMean score : 0.515

(partial model without unconserved sides chains): PDB file : Tito_1B8H.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1B8H-query.scw PDB file : Tito_Scwrl_1B8H.pdb: