Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MQRLEVYKNYQRLYDLRIAILLNLSTLYLYNQDKNMCKQICYTLLEDAKNKKSYDRLAICYVRIGICTDDSKLIQKGSPFWS 4YV6 Chain:B ((172-235)) ----AYSEQNKTNKTLVTQLSINCLIISIDYSYFDHSHYLIEKIEFLLRDELNFYEKTVFLYVHGYYK--------------

General information: TITO was launched using: RESULT: Template: 4YV6.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 173 -27059 -156.41 -422.79 target 2D structure prediction score : 0.52 Monomeric hydrophicity matching model chain B : 0.55 3D Compatibility (PKB) : -156.41 2D Compatibility (Sec. Struct. Predict.) : 0.52 1D Compatibility (Hydrophobicity) : 0.55 QMean score : 0.425

(partial model without unconserved sides chains): PDB file : Tito_4YV6.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4YV6-query.scw PDB file : Tito_Scwrl_4YV6.pdb: