Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSKQKKFEENLAELETIVQSLENGEIALEDAITAFQ-KGMVLSKELQATLDKAEKTLVKVMQEDGTESDFE 1MA9 Chain:A ((349-388)) -------------LEPTLKSL--GECC---STTCFNAKGPLLKKELSSFIDKGQ-----------------

General information: TITO was launched using: RESULT: Template: 1MA9.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 43 -4870 -113.24 -139.13 target 2D structure prediction score : 0.51 Monomeric hydrophicity matching model chain A : 0.77 3D Compatibility (PKB) : -113.24 2D Compatibility (Sec. Struct. Predict.) : 0.51 1D Compatibility (Hydrophobicity) : 0.77 QMean score : 0.602

(partial model without unconserved sides chains): PDB file : Tito_1MA9.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1MA9-query.scw PDB file : Tito_Scwrl_1MA9.pdb: