Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKGKEYENRTVSFAISSKGEKMKVENISYRVDHRILFDNISFDTSSSGVTLITGKNGTGKSTLL 1G6H Chain:A ((6-50)) -------------------EILRTENIVKYFGEFKALDGVSISVNKGDVTLIIGPNGSGKSTLI

General information: TITO was launched using: RESULT: Template: 1G6H.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 108 -9546 -88.39 -212.13 target 2D structure prediction score : 0.56 Monomeric hydrophicity matching model chain A : 0.70 3D Compatibility (PKB) : -88.39 2D Compatibility (Sec. Struct. Predict.) : 0.56 1D Compatibility (Hydrophobicity) : 0.70 QMean score : 0.418

(partial model without unconserved sides chains): PDB file : Tito_1G6H.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1G6H-query.scw PDB file : Tito_Scwrl_1G6H.pdb: