Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNDAQLIDKLGGVTAVARLLGITPPSVSGWK-A-IPLDKKIRLAVIAEDLGLTTRKELFPDNYQDIWIELRPQTTKSKNLGSLTA 1LLI Chain:B ((31-80)) ----------LSQESLADKLGMGQSGIGALFNGINALNAYNAALLAKILK--VSVEEFSPSI-----------------------

General information: TITO was launched using: RESULT: Template: 1LLI.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 128 -8121 -63.44 -169.18 target 2D structure prediction score : 0.46 Monomeric hydrophicity matching model chain B : 0.59 3D Compatibility (PKB) : -63.44 2D Compatibility (Sec. Struct. Predict.) : 0.46 1D Compatibility (Hydrophobicity) : 0.59 QMean score : 0.428

(partial model without unconserved sides chains): PDB file : Tito_1LLI.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1LLI-query.scw PDB file : Tito_Scwrl_1LLI.pdb: