Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MFQGYSKDRREETCSYCGAIYIVDIPGLPGHEEREEYFCPECSHVNFARASNSPRVSLVKARTDGKNDKSPSFQALIDSYKDE 5FMF Chain:L ((28-70)) ----------KYICAECSSKLSLSR--------TDAVRCKDCGHRILLK-ARTKRLVQFEAR---------------------

General information: TITO was launched using: RESULT: Template: 5FMF.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain L - contact count / total energy / energy per contact / energy per residue : 88 -10643 -120.94 -247.50 target 2D structure prediction score : 0.51 Monomeric hydrophicity matching model chain L : 0.67 3D Compatibility (PKB) : -120.94 2D Compatibility (Sec. Struct. Predict.) : 0.51 1D Compatibility (Hydrophobicity) : 0.67 QMean score : 0.380

(partial model without unconserved sides chains): PDB file : Tito_5FMF.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5FMF-query.scw PDB file : Tito_Scwrl_5FMF.pdb: