Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSLQRG-IYQHYKGNLYQVFSVAKHSETEEELVVYQCLYGDYSTWVRPLDMFTETVQMSDGSIVPRFKLIQST 1SGM Chain:A ((38-49)) --APKGSLYHFFPN-----------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 1SGM.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 5 -312 -62.30 -28.32 target 2D structure prediction score : 0.18 Monomeric hydrophicity matching model chain A : 0.49 3D Compatibility (PKB) : -62.30 2D Compatibility (Sec. Struct. Predict.) : 0.18 1D Compatibility (Hydrophobicity) : 0.49 QMean score : 0.937

(partial model without unconserved sides chains): PDB file : Tito_1SGM.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1SGM-query.scw PDB file : Tito_Scwrl_1SGM.pdb: