Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MFVALSFDWVFFFGVNMDTIEAKKNLNALCNEIEKLQNLSRSLMTAKEMLDIDAKIKRHKEQVKNIRSNLHA 3KFU Chain:G ((8-45)) -----------------------------PELLRKLETLAKIRLSPEEEALLLQDLKRILDFVDALP-----

General information: TITO was launched using: RESULT: Template: 3KFU.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain G - contact count / total energy / energy per contact / energy per residue : 41 -7051 -171.96 -185.54 target 2D structure prediction score : 0.71 Monomeric hydrophicity matching model chain G : 0.57 3D Compatibility (PKB) : -171.96 2D Compatibility (Sec. Struct. Predict.) : 0.71 1D Compatibility (Hydrophobicity) : 0.57 QMean score : 0.695

(partial model without unconserved sides chains): PDB file : Tito_3KFU.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3KFU-query.scw PDB file : Tito_Scwrl_3KFU.pdb: