Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSFWQKLFLADQQHNEHKNQTACVENDCSCKTNEQLLSALAQATDEDVIKGIKKVLISRGYSRKELNELTQKTSIH 2ZU0 Chain:A ((340-389)) -----------LAEVDTKPQLEIYADDVKCSHGA-----TVGRIDDEQI----FYLRSRGINQQDAQQMI------

General information: TITO was launched using: RESULT: Template: 2ZU0.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 64 -9365 -146.32 -187.29 target 2D structure prediction score : 0.50 Monomeric hydrophicity matching model chain A : 0.62 3D Compatibility (PKB) : -146.32 2D Compatibility (Sec. Struct. Predict.) : 0.50 1D Compatibility (Hydrophobicity) : 0.62 QMean score : 0.566

(partial model without unconserved sides chains): PDB file : Tito_2ZU0.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2ZU0-query.scw PDB file : Tito_Scwrl_2ZU0.pdb: