Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNDKELTFKEGHDILKQNAELLESQESPDI--DNLMKIVEESIGAYKACKSRIEAVQQALDETFKE- 2W83 Chain:C ((1-67)) AMDPEFMGREVENLILENTQLLETKNALNIVKNDLIAKVDELTCEKDVLQGELEAVKQAKLKLEEKN

General information: TITO was launched using: RESULT: Template: 2W83.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 8 544 68.00 8.50 target 2D structure prediction score : 0.78 Monomeric hydrophicity matching model chain C : 0.78 3D Compatibility (PKB) : 68.00 2D Compatibility (Sec. Struct. Predict.) : 0.78 1D Compatibility (Hydrophobicity) : 0.78 QMean score : 0.474

(partial model without unconserved sides chains): PDB file : Tito_2W83.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2W83-query.scw PDB file : Tito_Scwrl_2W83.pdb: