Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSAVNFNMRLEAELKEQVTPILEDYGLTMPQAFKLFLNQIVKTKAIPLSFDYARETALTPKAAAKLLQSLKEIENGEYTEYETVEEAIKAMSEEAHG 5HSN Chain:A ((36-96)) --------RVGAVLRPEVSAALSPLGLTLPE-F-VCLRMLSQSPGLS-SAELARHASVTPQAMNTVLRKLED-------------------------

General information: TITO was launched using: RESULT: Template: 5HSN.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 154 -28063 -182.22 -460.04 target 2D structure prediction score : 0.77 Monomeric hydrophicity matching model chain A : 0.74 3D Compatibility (PKB) : -182.22 2D Compatibility (Sec. Struct. Predict.) : 0.77 1D Compatibility (Hydrophobicity) : 0.74 QMean score : 0.829

(partial model without unconserved sides chains): PDB file : Tito_5HSN.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5HSN-query.scw PDB file : Tito_Scwrl_5HSN.pdb: