Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLPFFIYWGVILACIAWLALSVYFSVFYLVRKENGNLWAFALFNVIAAIVLAITLAVYRTWGWGITQYSSLIYLILAIYGVVVLLQAILGREPKKAAA 5H2F Chain:L ((15-33)) ---TSLYLGLLLILV----LALLFSS------------------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 5H2F.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain L - contact count / total energy / energy per contact / energy per residue : 1 -79 -79.00 -4.16 target 2D structure prediction score : 0.79 Monomeric hydrophicity matching model chain L : 0.43 3D Compatibility (PKB) : -79.00 2D Compatibility (Sec. Struct. Predict.) : 0.79 1D Compatibility (Hydrophobicity) : 0.43 QMean score : 0.619

(partial model without unconserved sides chains): PDB file : Tito_5H2F.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5H2F-query.scw PDB file : Tito_Scwrl_5H2F.pdb: