Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MWIAHKMDMSMKLIHQAERYLAEKAYRTQKKEFLPKTAVTNRKENKKERQLFAKGDRIFVNEYQKEALVYEDIGEDTIDVYLDKKIIHVPRQRVRLVRSAEDLYPTGYDLDSLFIDYKTRKRQRDLERGSKKAHKVLVKEMRKRQEERRVNDENSK 4BKK Chain:B ((77-150)) --------------------------------------------------------------------------EDTIKILRDAGY-HVKANGVDVTTHRQDINGKEMKFEVLTLASLTTEIQINIEIESRKSYKKMLKEMGEVAPEYR-------

General information: TITO was launched using: RESULT: Template: 4BKK.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 125 -9305 -74.44 -125.74 target 2D structure prediction score : 0.38 Monomeric hydrophicity matching model chain B : 0.66 3D Compatibility (PKB) : -74.44 2D Compatibility (Sec. Struct. Predict.) : 0.38 1D Compatibility (Hydrophobicity) : 0.66 QMean score : 0.212

(partial model without unconserved sides chains): PDB file : Tito_4BKK.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4BKK-query.scw PDB file : Tito_Scwrl_4BKK.pdb: