Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MQNSSNKLPKTYNHIAFKIDEQDIDSFVSKIQMLGLTVEPGRSRVKGEASSIYFYDYDNHLFELHTGTLQERLKSYNSTT 1R9C Chain:A ((65-128)) ---------RSYNHIAFKIDDADFDRYAERVGKLGLDMRPPRP-----GRSIYFYDDDNHMFELHTGTLTERL-------

General information: TITO was launched using: RESULT: Template: 1R9C.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 179 -22401 -125.15 -379.68 target 2D structure prediction score : 0.68 Monomeric hydrophicity matching model chain A : 0.83 3D Compatibility (PKB) : -125.15 2D Compatibility (Sec. Struct. Predict.) : 0.68 1D Compatibility (Hydrophobicity) : 0.83 QMean score : 0.683

(partial model without unconserved sides chains): PDB file : Tito_1R9C.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1R9C-query.scw PDB file : Tito_Scwrl_1R9C.pdb: