Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MEAGKVLQEVKALCADKKYEEAKSLIEKNKENLEEKYPIAQEFIELKQGTILHRFKHFFGITE 3BV8 Chain:A ((50-72)) --------------IFCEADDWKPFYEAYGSQFEDIE--------------------------

General information: TITO was launched using: RESULT: Template: 3BV8.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 18 -3069 -170.47 -133.41 target 2D structure prediction score : 0.17 Monomeric hydrophicity matching model chain A : 0.56 3D Compatibility (PKB) : -170.47 2D Compatibility (Sec. Struct. Predict.) : 0.17 1D Compatibility (Hydrophobicity) : 0.56 QMean score : 0.768

(partial model without unconserved sides chains): PDB file : Tito_3BV8.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3BV8-query.scw PDB file : Tito_Scwrl_3BV8.pdb: