Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence -----------------------------------------------MHMESIRYFDGEKHIEYSNTQEDVDFISFEEDKITKVNFKDGTCLKIVSPYIEYKSKWEQDDSDERDRFGW-------- 5KXF Chain:A ((30-156)) HIWRGMIAKGGTPVCCARCVPMETKLPEVVNCSARTDLNMLAKHYAVAIGCEIVFFVPDREEDFASYTEFLRYLS-SKDRAGVAKLDDGTTLFLVPPSDFLTDVLQVTRQER--LYGVVLKLPPPA

General information: TITO was launched using: RESULT: Template: 5KXF.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 173 17536 101.36 257.88 target 2D structure prediction score : 0.51 Monomeric hydrophicity matching model chain A : 0.60 3D Compatibility (PKB) : 101.36 2D Compatibility (Sec. Struct. Predict.) : 0.51 1D Compatibility (Hydrophobicity) : 0.60 QMean score : 0.252

(partial model without unconserved sides chains): PDB file : Tito_5KXF.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5KXF-query.scw PDB file : Tito_Scwrl_5KXF.pdb: