Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MIIPNSLEELAGYVETGKSVFFFTAGWCGDCRFIKPQMPEIENDFS-DWQFIEVDRDKYIDVAAEWNIFGIPSFVVIQDGKELGRLVNKDRK--TKQEIESFLESVTKG 4BA7 Chain:B ((26-106)) ----------------------FWAPWCGPCRMIAPIIEELAEEYEGKVKFAKVNVDENPETAAKYGIMSIPTLLLFKNGEVVDKLVGARPKEALKERIEKHL------

General information: TITO was launched using: RESULT: Template: 4BA7.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 254 -13849 -54.52 -177.54 target 2D structure prediction score : 0.55 Monomeric hydrophicity matching model chain B : 0.72 3D Compatibility (PKB) : -54.52 2D Compatibility (Sec. Struct. Predict.) : 0.55 1D Compatibility (Hydrophobicity) : 0.72 QMean score : 0.501

(partial model without unconserved sides chains): PDB file : Tito_4BA7.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4BA7-query.scw PDB file : Tito_Scwrl_4BA7.pdb: