Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence CFY-TVSRKEATEMLQKNPSLGNMILRPG-SDSRNYSITIRQEIDIPRIKHYKVMSVGQNYTIELEKPVTLPNLFSVIDYF 2CIA Chain:A ((7-81)) WYYGNVTRHQAECALNERGVEGDFLIRDSESSPSDFSVSLKASG---KNKHFKVQLVDNVYCIGQ---RRFHTMDELVEHY

General information: TITO was launched using: RESULT: Template: 2CIA.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 268 -979 -3.65 -13.40 target 2D structure prediction score : 0.78 Monomeric hydrophicity matching model chain A : 0.75 3D Compatibility (PKB) : -3.65 2D Compatibility (Sec. Struct. Predict.) : 0.78 1D Compatibility (Hydrophobicity) : 0.75 QMean score : 0.643

(partial model without unconserved sides chains): PDB file : Tito_2CIA.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2CIA-query.scw PDB file : Tito_Scwrl_2CIA.pdb: