Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKEKEFRRNMAVFPIGSVMKLTDLSARQIRYYEDQELIKPDRNEGNRRMYSLNDMDRLLEIKDYISEGYNIAAIKKKYAEREAKSKKAVSQTEVRRALHNELLQQGRFASVQSPFGRG 4R24 Chain:B ((3-80)) ------YRDKKVMSIGIVKELTGLSERQIRYYEKRSLLFPDRTNTGIRKYSFSDVERLMDIADRIEEGVQTSEIRTELAKKDEA----------------------------------

General information: TITO was launched using: RESULT: Template: 4R24.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 259 -27094 -104.61 -347.35 target 2D structure prediction score : 0.56 Monomeric hydrophicity matching model chain B : 0.74 3D Compatibility (PKB) : -104.61 2D Compatibility (Sec. Struct. Predict.) : 0.56 1D Compatibility (Hydrophobicity) : 0.74 QMean score : 0.673

(partial model without unconserved sides chains): PDB file : Tito_4R24.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4R24-query.scw PDB file : Tito_Scwrl_4R24.pdb: