Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MTAREQGVVKWFNDTKGFGFIQRN-------G-GDDVFVHFRAIVGDGHRSLRDGQRVEFSVVQGQKGFQAENVQPLD 3ULJ Chain:B ((6-81)) -VLRGSGHCKWFNVRMGFGFISMTSREGSPLENPVDVFVHQSKLYMEGFRSLKEGEPVEFTFK-SSKGFESLRVTGP-

General information: TITO was launched using: RESULT: Template: 3ULJ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 255 -5910 -23.17 -88.20 target 2D structure prediction score : 0.70 Monomeric hydrophicity matching model chain B : 0.73 3D Compatibility (PKB) : -23.17 2D Compatibility (Sec. Struct. Predict.) : 0.70 1D Compatibility (Hydrophobicity) : 0.73 QMean score : 0.716

(partial model without unconserved sides chains): PDB file : Tito_3ULJ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3ULJ-query.scw PDB file : Tito_Scwrl_3ULJ.pdb: