Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WYYGNVTRHQAECALNERGVEGDFLIRDSESSPSDFSVSLKASGKNKHFKVQLVDNV--YCIGQRRFHTMDELVEHY 3IMD Chain:B ((8-83)) WFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKV-LRDGAGKYFLWVVKFNSLNELVDYH

General information: TITO was launched using: RESULT: Template: 3IMD.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 258 -13609 -52.75 -183.91 target 2D structure prediction score : 0.74 Monomeric hydrophicity matching model chain B : 0.82 3D Compatibility (PKB) : -52.75 2D Compatibility (Sec. Struct. Predict.) : 0.74 1D Compatibility (Hydrophobicity) : 0.82 QMean score : 0.596

(partial model without unconserved sides chains): PDB file : Tito_3IMD.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3IMD-query.scw PDB file : Tito_Scwrl_3IMD.pdb: