Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMISNKVDITLANFTVTDERKKQVDFALPYMKVSLGVVSPKTGLITDVKQLEGKTLIVTKGTTAETYFEKNHP-----EIKLQ-KYDQYSDSYQALLDGRGDAFSTDNTEVLAWALENK--GFEVGITSLGDPDTIAAAVQKGNQELLDFINKDIEKLGKENFFHKAYEKTLHPTYGDAAKADDLVVEGGH
4C0R Chain:A ((58-239))LDSDKYQIGANNISYTKERANKYLYSNPTASNPLVLVVPKDSDIKSYNDIAGHSTQVVQGNTTVPMLQKFNKNHENNQVKLNFTSEDLAHQIRNVSDGKYDFKIFEKISAETIIKEQGLDNLKVIDLPSDQKPYVYFIFAQDQKDLQKFVNKRLKKLYENGTLEKLSKKYLGGSYLPDKKDM--------


General information:
TITO was launched using:
RESULT:

Template: 4C0R.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 714 17062 23.90 98.05
target 2D structure prediction score : 0.55
Monomeric hydrophicity matching model chain A : 0.75

3D Compatibility (PKB) : 23.90
2D Compatibility (Sec. Struct. Predict.) : 0.55
1D Compatibility (Hydrophobicity) : 0.75
QMean score : 0.583

(partial model without unconserved sides chains):
PDB file : Tito_4C0R.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4C0R-query.scw
PDB file : Tito_Scwrl_4C0R.pdb: