Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MRKRDRHQLIKKMITEEKLSTQKEIQDRLEAHNVCVTQTTLSRDLREIGLTKVKKNDMVYYVLVNETEKIDLVEFLSHHLEGVARAEFTLVLHTKLGEASVLANIVDVNKDEWILGTVAGANTLLVICRDQHVAKLMEDRLLDLMKDK 2P5M Chain:B ((7-83)) --------------------------------------------------------------------LSKLKRALMDAFVKIDSASHMIVLKTMPGNAQAIGALMDNLDWDEMMGTICGDDTILIICRTPEDTEGVKNRLLELL---

General information: TITO was launched using: RESULT: Template: 2P5M.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 331 -62340 -188.34 -809.60 target 2D structure prediction score : 0.71 Monomeric hydrophicity matching model chain B : 0.69 3D Compatibility (PKB) : -188.34 2D Compatibility (Sec. Struct. Predict.) : 0.71 1D Compatibility (Hydrophobicity) : 0.69 QMean score : 0.609

(partial model without unconserved sides chains): PDB file : Tito_2P5M.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2P5M-query.scw PDB file : Tito_Scwrl_2P5M.pdb: