Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMQLTLVRHGEAAPPVN-GNDIKRPLTARGHAQAEQTATFLKDIV-KPNIFVVSPLLRAQETLAHIQTYFKDVPVLLCDKIKPDDDAKEAIEWLSQI-PYESIVVVCHMNVVGHIAELLTHET------FNPFALAEARIYDQAVIANGLSTQKNSFIPTI
2RFL Chain:H ((9-169))TRVYLLRHAKAAWAAPGERDFDRGLNEAGFAEAEIIADLAADRRYRPDLILSSTAARCRQTTQAWQRAF--IDIVYIDEMYN-ARSETYLSLIAAQTEVQSVMLVGHNPTMEATLEAMIGEDLLHAALPSGFPTSGLAVLDQD---KNRWRLIDFLAP--


General information:
TITO was launched using:
RESULT:

Template: 2RFL.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain H - contact count / total energy / energy per contact / energy per residue : 684 1035 1.51 7.23
target 2D structure prediction score : 0.68
Monomeric hydrophicity matching model chain H : 0.71

3D Compatibility (PKB) : 1.51
2D Compatibility (Sec. Struct. Predict.) : 0.68
1D Compatibility (Hydrophobicity) : 0.71
QMean score : 0.523

(partial model without unconserved sides chains):
PDB file : Tito_2RFL.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2RFL-query.scw
PDB file : Tito_Scwrl_2RFL.pdb: