Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceWFFGAIGRSDAEKQLLYSENKTGSFLIRESESQKGEFSLSVLD-----GAVVKHYRIKRLDEGGFFLTRRRIFSTLNEFVSHY
1SPS Chain:C ((5-87))WYFGKITRRESERLLLNPENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFSSLQQLVAYY


General information:
TITO was launched using:
RESULT:

Template: 1SPS.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 267 1504 5.63 19.28
target 2D structure prediction score : 0.58
Monomeric hydrophicity matching model chain C : 0.86

3D Compatibility (PKB) : 5.63
2D Compatibility (Sec. Struct. Predict.) : 0.58
1D Compatibility (Hydrophobicity) : 0.86
QMean score : 0.647

(partial model without unconserved sides chains):
PDB file : Tito_1SPS.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1SPS-query.scw
PDB file : Tito_Scwrl_1SPS.pdb: