Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MDIRKIKKLIDLMIESDLQAIEVKEGDQSIALTRRNPVVAAAGVALPAAPVAEAPVAKTPRGAVETSPMVGVFYAAPSPGEAPFVKVGQTVSAGETLGIIEAMKIMNPIEATQSGVIEEILVKNGEVIQFGQPLFRYRA 3N6R Chain:G ((609-681)) ----------------------------------------------------------PDTSKMLLCPMPGLIVK-------VDVEVGQEVQEGQALCTIEAMKMENILRAEKKGVVAKINASAGNSLAVDDVIMEFE-

General information: TITO was launched using: RESULT: Template: 3N6R.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain G - contact count / total energy / energy per contact / energy per residue : 320 -41367 -129.27 -566.67 target 2D structure prediction score : 0.38 Monomeric hydrophicity matching model chain G : 0.66 3D Compatibility (PKB) : -129.27 2D Compatibility (Sec. Struct. Predict.) : 0.38 1D Compatibility (Hydrophobicity) : 0.66 QMean score : 0.461

(partial model without unconserved sides chains): PDB file : Tito_3N6R.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3N6R-query.scw PDB file : Tito_Scwrl_3N6R.pdb: