Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MDIRKIKKLIDLMIESDLQAIEVKEGDQSIALTRRNPVVAAAGVALPAAPVAEAPVAKTPRGAVETSPMVGVFYAAPSPGEAPFVKVGQTVSAGETLGIIEAMKIMNPIEATQSGVIEEILVKNGEVIQFGQPLFRYRA 2EJM Chain:A ((12-83)) -----------------------------------------------------------ETQGGPLAPMTGTIEK-------VFVKAGDKVKAGDSLMVMIAMKMEHTIKSPKDGTVKKVFYREGAQANRHTPLVEFE-

General information: TITO was launched using: RESULT: Template: 2EJM.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 330 -34759 -105.33 -482.76 target 2D structure prediction score : 0.42 Monomeric hydrophicity matching model chain A : 0.65 3D Compatibility (PKB) : -105.33 2D Compatibility (Sec. Struct. Predict.) : 0.42 1D Compatibility (Hydrophobicity) : 0.65 QMean score : 0.431

(partial model without unconserved sides chains): PDB file : Tito_2EJM.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2EJM-query.scw PDB file : Tito_Scwrl_2EJM.pdb: