Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WFFGAIRRSDAEKQLLYSENKTGSFLIRESESQKGEFSLSVLD-----GAVVKHYRIKRLDEGGFFLTRRRIFSTLNEFVSHY 1SPS Chain:C ((5-87)) WYFGKITRRESERLLLNPENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFSSLQQLVAYY

General information: TITO was launched using: RESULT: Template: 1SPS.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 267 1402 5.25 17.97 target 2D structure prediction score : 0.54 Monomeric hydrophicity matching model chain C : 0.85 3D Compatibility (PKB) : 5.25 2D Compatibility (Sec. Struct. Predict.) : 0.54 1D Compatibility (Hydrophobicity) : 0.85 QMean score : 0.622

(partial model without unconserved sides chains): PDB file : Tito_1SPS.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1SPS-query.scw PDB file : Tito_Scwrl_1SPS.pdb: