Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MTAREQGVVKWFNDTKGFGFIQRNGGDDVFVHFRAIVGDGHRSLRDGQRVEFSVVQGQKGFQAENVQPLD 5JX4 Chain:B ((2-66)) --HMQRGKVKWFNNEKGYGFIEVEGGSDVFVHFTAIQG--FKTLEEGQEVSFEIVQGNRGPQAANVVKL-

General information: TITO was launched using: RESULT: Template: 5JX4.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 291 -34326 -117.96 -528.09 target 2D structure prediction score : 0.57 Monomeric hydrophicity matching model chain B : 0.82 3D Compatibility (PKB) : -117.96 2D Compatibility (Sec. Struct. Predict.) : 0.57 1D Compatibility (Hydrophobicity) : 0.82 QMean score : 0.660

(partial model without unconserved sides chains): PDB file : Tito_5JX4.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5JX4-query.scw PDB file : Tito_Scwrl_5JX4.pdb: