Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMAIERTLSIVKPDAVSKNHIGEIFARFEKAGLKIVATKMKHLSQADAEGFYAEHKERGFFGDLVAFMTSGPVVVSVLEGENAVLAHREILGATNPKEAAPGTIRADFAVSIDENAAHGSDSVASAEREIAYFFADNEICPRTR
3NGU Chain:A ((1-142))MSSERTFIAVKPDGVQRGLVGEIIARFERKGYKLVALKILQPTTEQAQGHYKDLCSKPFFPALVKYFSSGPIVCMVWEGKNVVKSGRVLLGATNPADSQPGTIRGDFAVDVGRNVCHGSDSVESAEREIAFWFKADEIASWT-


General information:
TITO was launched using:
RESULT:

Template: 3NGU.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 662 -63261 -95.56 -445.50
target 2D structure prediction score : 0.60
Monomeric hydrophicity matching model chain A : 0.86

3D Compatibility (PKB) : -95.56
2D Compatibility (Sec. Struct. Predict.) : 0.60
1D Compatibility (Hydrophobicity) : 0.86
QMean score : 0.401

(partial model without unconserved sides chains):
PDB file : Tito_3NGU.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3NGU-query.scw
PDB file : Tito_Scwrl_3NGU.pdb: