Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WFHEGLSRHQAENLLMG-KEVGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRDNKGNYFLWTEKFPSLNKLVDYY 3MXC Chain:A ((9-84)) WFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYH

General information: TITO was launched using: RESULT: Template: 3MXC.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 270 -15352 -56.86 -204.69 target 2D structure prediction score : 0.64 Monomeric hydrophicity matching model chain A : 0.86 3D Compatibility (PKB) : -56.86 2D Compatibility (Sec. Struct. Predict.) : 0.64 1D Compatibility (Hydrophobicity) : 0.86 QMean score : 0.783

(partial model without unconserved sides chains): PDB file : Tito_3MXC.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3MXC-query.scw PDB file : Tito_Scwrl_3MXC.pdb: