Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MIKGIGIDAVELPRITRLIEE-KPKFIARILTSDEMKLFQSLPFHRQVEFLGGRYACKEAFSKAWGTGIGK-VPFKMSRF 5CMO Chain:B ((1-76)) MIYGIGTDIVSLKRIIRLNKKFGQAFAGRILTPEELLEFPQA--GKPVNYLAKRFAAKEAFAKAVGTGIRGAVSFRNI--

General information: TITO was launched using: RESULT: Template: 5CMO.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 208 -10533 -50.64 -142.33 target 2D structure prediction score : 0.73 Monomeric hydrophicity matching model chain B : 0.78 3D Compatibility (PKB) : -50.64 2D Compatibility (Sec. Struct. Predict.) : 0.73 1D Compatibility (Hydrophobicity) : 0.78 QMean score : 0.521

(partial model without unconserved sides chains): PDB file : Tito_5CMO.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5CMO-query.scw PDB file : Tito_Scwrl_5CMO.pdb: