Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MGFTEETVRFKLDDSNKKEISETLTDVYASLNDKGYNPINQI--VGYVLSGDPAYVPRYNNARNQIRKYERDEIVEELVRYYLKGQGVDL 3VX0 Chain:A ((218-252)) ----------------------------------GYNKAAGVYCIGEVLDGDPAYTCPYQNVMDGVLNY---------------------

General information: TITO was launched using: RESULT: Template: 3VX0.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 65 4998 76.88 151.44 target 2D structure prediction score : 0.27 Monomeric hydrophicity matching model chain A : 0.63 3D Compatibility (PKB) : 76.88 2D Compatibility (Sec. Struct. Predict.) : 0.27 1D Compatibility (Hydrophobicity) : 0.63 QMean score : 0.302

(partial model without unconserved sides chains): PDB file : Tito_3VX0.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3VX0-query.scw PDB file : Tito_Scwrl_3VX0.pdb: