Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MPRTFPCPRCGEPSVWEGNEFRPFCSERCKLIDLGAWANDEYRLPTQDAPQQDKGSQHEDDYED 2K5C Chain:A ((8-21)) ---MAKCPICGSPLKWE-----------------------------------------------

General information: TITO was launched using: RESULT: Template: 2K5C.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 14 -1190 -85.00 -85.00 target 2D structure prediction score : 0.71 Monomeric hydrophicity matching model chain A : 0.66 3D Compatibility (PKB) : -85.00 2D Compatibility (Sec. Struct. Predict.) : 0.71 1D Compatibility (Hydrophobicity) : 0.66 QMean score : 1.019

(partial model without unconserved sides chains): PDB file : Tito_2K5C.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2K5C-query.scw PDB file : Tito_Scwrl_2K5C.pdb: