Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNKLLVALGLAATVALVGCNKDKAPETGATTGEHLENSAQQASADIKSAGDQAASDIATATDNASAKIDAATDH--AADATAKAAAETEATARKATADTAQAVENAAADVKKDAQH 2FY5 Chain:A ((435-500)) ------------------------------------------SASIRRFQEGRVDNIRSATPEALAFVRAVTDHKAAVPASEKLLLLKDAI-RAQTAYTVMAITGMAID-------

General information: TITO was launched using: RESULT: Template: 2FY5.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 153 6259 40.91 97.80 target 2D structure prediction score : 0.31 Monomeric hydrophicity matching model chain A : 0.66 3D Compatibility (PKB) : 40.91 2D Compatibility (Sec. Struct. Predict.) : 0.31 1D Compatibility (Hydrophobicity) : 0.66 QMean score : 0.329

(partial model without unconserved sides chains): PDB file : Tito_2FY5.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2FY5-query.scw PDB file : Tito_Scwrl_2FY5.pdb: